GET /api/protein/UniProt/A0A0J6Y5F0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0J6Y5F0",
"id": "A0A0J6Y5F0_COCIT",
"source_organism": {
"taxId": "404692",
"scientificName": "Coccidioides immitis RMSCC 2394",
"fullName": "Coccidioides immitis RMSCC 2394"
},
"name": "Hsp70 nucleotide exchange factor FES1",
"description": [
"Functions as a nucleotide exchange factor (NEF) for Hsp70 chaperones which accelerates the release of ADP. Required for fully efficient Hsp70-mediated folding of proteins"
],
"length": 212,
"sequence": "MDSHMNNLLKWSIENSVPAQPDDPEQVKQERSLDRLDTEALQRLLSNAPSDADLMKAAMEVVSDDSATLENKLIAFDNFEQLIENLDNANNMGVLGLWTPLVEALSDAEPQMRKMAAWCIGTAVQNNEMAQNKLLDFKAVPKLLSLAKTDPDTTVRRKAIYALSSAVRNHQPSLDELQKLLPADYVSEGEKMNAADMDRIDAIMNKLKEIPA",
"proteome": null,
"gene": "CIRG_10082",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "44d776e89c30c71a50a62a7d7affcaeff4c33ba0",
"counters": {
"domain_architectures": 127,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 127
}
}
}