GET /api/protein/UniProt/A0A0H5CH63/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0H5CH63",
        "id": "A0A0H5CH63_CYBJN",
        "source_organism": {
            "taxId": "983966",
            "scientificName": "Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542)",
            "fullName": "Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast)"
        },
        "name": "pyridoxal 5'-phosphate synthase",
        "description": null,
        "length": 221,
        "sequence": "MVDENPIIFAPKTYQYDKDSLDISQVAEDPFVQFKNWFDEATKSESIPECTNFSTAELPSGRVSNRVVLFKELDHKGFVVYSNWGSSKKARDVKSNPHAALTWFWPTLQRQVRVEGVTEFVDRETSQRYFDTRPRGSKIGAWSSPQSSVLKNRDELSEVYAQREKEFEGKEEIPCPDYWGGLRTIPLEIEFWQGRPSRLHDRIVYRRATPEDPWEIVRISP",
        "proteome": "UP000094389",
        "gene": "PDX3",
        "go_terms": [
            {
                "identifier": "GO:0004733",
                "name": "pyridoxamine phosphate oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008615",
                "name": "pyridoxine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016638",
                "name": "oxidoreductase activity, acting on the CH-NH2 group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b1ec9dec797efe48ef99d7dd910cd2ef548f8153",
        "counters": {
            "domain_architectures": 21075,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21075
        }
    }
}