GET /api/protein/UniProt/A0A0H3PT67/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0H3PT67",
"id": "A0A0H3PT67_ECO5C",
"source_organism": {
"taxId": "478008",
"scientificName": "Escherichia coli O157:H7 (strain EC869)",
"fullName": "Escherichia coli O157:H7 (strain EC869)"
},
"name": "Surface composition regulator",
"description": [
"Major determinant of cell surface composition. Negatively regulates motility, adhesion and synthesis of biofilm exopolysaccharides"
],
"length": 66,
"sequence": "MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQTRELELEH",
"proteome": null,
"gene": "glgS",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "596d55326459c806cb9662cda9c49fa3d748e686",
"counters": {
"domain_architectures": 722,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 722
}
}
}