General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0H3KW29",
        "id": "A0A0H3KW29_PANAA",
        "source_organism": {
            "taxId": "932677",
            "scientificName": "Pantoea ananatis (strain AJ13355)",
            "fullName": "Pantoea ananatis (strain AJ13355)"
        },
        "name": "Ascorbate-specific PTS system EIIA component",
        "description": [
            "The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II UlaABC PTS system is involved in ascorbate transport"
        ],
        "length": 145,
        "sequence": "MTIKQLLQEANAVQVGIAARDWQQVIAMAARPLVEGGYIQASYPQAVIENTLTHGAYYVFEEGIAIPHARPETGVIRDCFSMVLLSEPVSFDGSDKADIVIMFGARDSNAHIEEGIRAIVTLLEDEETLVRLRQASSVAEVMEIL",
        "proteome": null,
        "gene": "ulaC",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "63916ddc97314a696e2eb523d0b2663c7608f198",
        "counters": {
            "domain_architectures": 28786,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 2,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28786
        }
    }
}