GET /api/protein/UniProt/A0A0H2R3K9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0H2R3K9",
        "id": "A0A0H2R3K9_9AGAM",
        "source_organism": {
            "taxId": "27342",
            "scientificName": "Schizopora paradoxa",
            "fullName": "Schizopora paradoxa"
        },
        "name": "Phenylalanine--tRNA ligase, mitochondrial",
        "description": [
            "Is responsible for the charging of tRNA(Phe) with phenylalanine in mitochondrial translation"
        ],
        "length": 452,
        "sequence": "MFGLRRPPKHASHAFRSWTNTFLRRSLAAPTSRPPSIEILGGTYPTDETTNITPSIISKLPERLYSRPGHPIHILKSLIESHFNQHGAPSTFHCPSADSFSPLVTPKQNFDDLSFPSDHPGRSLQDSYYVNRDLLLRTHTSAHEVELFASGHNSWLFTSDVYRRDEIDASHYPVFHQMEGASVFSTNVTGMKDLVDNIEYTRYATDQKDLEIEDLTVINDENPYQLDHDPEQVDLVIESLKLSINGLLLKLFRDAAGVSRADPLRVRWIPAYFPFTTPSYEVEVFFNGKWLEILGCGVVQDATLQHANVKNKLGWAFGLGLERIAMILTSIPDIRLFWSKDHRFLSQFSSGNLTKFQPYSKYPACYKDLSFWLPGPTVEHNDVFDLVRDCAGDLVENVELIDDFIHPKNQKRSLCFRINYRSMDRSLSNEEVNEIHTRVASLSKDRLGVEIR",
        "proteome": "UP000053477",
        "gene": "SCHPADRAFT_838771",
        "go_terms": [
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043039",
                "name": "tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004826",
                "name": "phenylalanine-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006432",
                "name": "phenylalanyl-tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "cb03b88fec293efb509895f29648b7d80ded8af1",
        "counters": {
            "domain_architectures": 2611,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "smart": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2611
        }
    }
}