HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0H2R3K9",
"id": "A0A0H2R3K9_9AGAM",
"source_organism": {
"taxId": "27342",
"scientificName": "Schizopora paradoxa",
"fullName": "Schizopora paradoxa"
},
"name": "Phenylalanine--tRNA ligase, mitochondrial",
"description": [
"Is responsible for the charging of tRNA(Phe) with phenylalanine in mitochondrial translation"
],
"length": 452,
"sequence": "MFGLRRPPKHASHAFRSWTNTFLRRSLAAPTSRPPSIEILGGTYPTDETTNITPSIISKLPERLYSRPGHPIHILKSLIESHFNQHGAPSTFHCPSADSFSPLVTPKQNFDDLSFPSDHPGRSLQDSYYVNRDLLLRTHTSAHEVELFASGHNSWLFTSDVYRRDEIDASHYPVFHQMEGASVFSTNVTGMKDLVDNIEYTRYATDQKDLEIEDLTVINDENPYQLDHDPEQVDLVIESLKLSINGLLLKLFRDAAGVSRADPLRVRWIPAYFPFTTPSYEVEVFFNGKWLEILGCGVVQDATLQHANVKNKLGWAFGLGLERIAMILTSIPDIRLFWSKDHRFLSQFSSGNLTKFQPYSKYPACYKDLSFWLPGPTVEHNDVFDLVRDCAGDLVENVELIDDFIHPKNQKRSLCFRINYRSMDRSLSNEEVNEIHTRVASLSKDRLGVEIR",
"proteome": "UP000053477",
"gene": "SCHPADRAFT_838771",
"go_terms": [
{
"identifier": "GO:0000049",
"name": "tRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043039",
"name": "tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004826",
"name": "phenylalanine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006432",
"name": "phenylalanyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "cb03b88fec293efb509895f29648b7d80ded8af1",
"counters": {
"domain_architectures": 2611,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 2,
"pfam": 2,
"smart": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2611
}
}
}