HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0G9FFM3",
"id": "A0A0G9FFM3_LACPN",
"source_organism": {
"taxId": "1590",
"scientificName": "Lactiplantibacillus plantarum",
"fullName": "Lactiplantibacillus plantarum"
},
"name": "DNA replication and repair protein RecF",
"description": [
"The RecF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-stranded, linear DNA. It also seems to bind ATP"
],
"length": 374,
"sequence": "MYLENLVLHDFRNYADLTINFSQGVNVLLGENAQGKTNLLEAIYVLALTRSHRTANDKELIRWQTTTATLQGRLHKSTGAVPLELELGRRGKRAKVNHLEQAKLSQYVGNLNVIVFAPEDLSIVKGAPAVRRRFMDMEFGQMSPKYLYNLSQYRTILKQRNQYLRQLNRQQAKDKVYLGVLSDQLAAFGAEIIHKRLQLLQQLEKWAQAVHSEITQEQEQLTFHYVTQVPTADQTSVDHIYQTLQALYQQQQAKEIFQGTTLLGPHRDDLQFGVNGKNVQTFGSQGQQRTTALSVKLAEIDLMKAETGEYPVLLLDDVLSELDAARQTHLLTAIQDKVQTFLTTPSLDGVARKLINAPKVFEVSHGTLHEEEPH",
"proteome": null,
"gene": "recF",
"go_terms": [
{
"identifier": "GO:0003697",
"name": "single-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b42beda06cfbc953a9c1115cd01312223a10d27",
"counters": {
"domain_architectures": 61955,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cdd": 1,
"cathgene3d": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 61955
}
}
}