GET /api/protein/UniProt/A0A0G9FFM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0G9FFM3",
        "id": "A0A0G9FFM3_LACPN",
        "source_organism": {
            "taxId": "1590",
            "scientificName": "Lactiplantibacillus plantarum",
            "fullName": "Lactiplantibacillus plantarum"
        },
        "name": "DNA replication and repair protein RecF",
        "description": [
            "The RecF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-stranded, linear DNA. It also seems to bind ATP"
        ],
        "length": 374,
        "sequence": "MYLENLVLHDFRNYADLTINFSQGVNVLLGENAQGKTNLLEAIYVLALTRSHRTANDKELIRWQTTTATLQGRLHKSTGAVPLELELGRRGKRAKVNHLEQAKLSQYVGNLNVIVFAPEDLSIVKGAPAVRRRFMDMEFGQMSPKYLYNLSQYRTILKQRNQYLRQLNRQQAKDKVYLGVLSDQLAAFGAEIIHKRLQLLQQLEKWAQAVHSEITQEQEQLTFHYVTQVPTADQTSVDHIYQTLQALYQQQQAKEIFQGTTLLGPHRDDLQFGVNGKNVQTFGSQGQQRTTALSVKLAEIDLMKAETGEYPVLLLDDVLSELDAARQTHLLTAIQDKVQTFLTTPSLDGVARKLINAPKVFEVSHGTLHEEEPH",
        "proteome": null,
        "gene": "recF",
        "go_terms": [
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b42beda06cfbc953a9c1115cd01312223a10d27",
        "counters": {
            "domain_architectures": 61955,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 61955
        }
    }
}