General Handler

HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "A0A0G8TT39",
        "id": "A0A0G8TT39_XANPE",
        "source_organism": {
            "taxId": "442694",
            "scientificName": "Xanthomonas perforans",
            "fullName": "Xanthomonas perforans"
        },
        "name": "Pimeloyl-[acyl-carrier protein] methyl ester esterase",
        "description": [
            "The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters"
        ],
        "length": 253,
        "sequence": "MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPGHGFSRDDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMIAATPRFVRGNDWPSAVQREVFVQFGIELSRDYRGTLERFLALDTLGSAHARSELRSLRETLTARGEPAPEALQQGLALLERTDLRRAVPQLARPSLWIAGQRDRLVPAAGMHAAAALSPHAQALTIAGGGHAPFLGHADQVSEALQRFVASVP",
        "proteome": "UP000035369",
        "gene": "bioH",
        "go_terms": [
            {
                "identifier": "GO:0052689",
                "name": "carboxylic ester hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009102",
                "name": "biotin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
        "counters": {
            "domain_architectures": 386493,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 386493
        }
    }
}