GET /api/protein/UniProt/A0A0G8TT39/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "A0A0G8TT39",
"id": "A0A0G8TT39_XANPE",
"source_organism": {
"taxId": "442694",
"scientificName": "Xanthomonas perforans",
"fullName": "Xanthomonas perforans"
},
"name": "Pimeloyl-[acyl-carrier protein] methyl ester esterase",
"description": [
"The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters"
],
"length": 253,
"sequence": "MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPGHGFSRDDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMIAATPRFVRGNDWPSAVQREVFVQFGIELSRDYRGTLERFLALDTLGSAHARSELRSLRETLTARGEPAPEALQQGLALLERTDLRRAVPQLARPSLWIAGQRDRLVPAAGMHAAAALSPHAQALTIAGGGHAPFLGHADQVSEALQRFVASVP",
"proteome": "UP000035369",
"gene": "bioH",
"go_terms": [
{
"identifier": "GO:0052689",
"name": "carboxylic ester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009102",
"name": "biotin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
"counters": {
"domain_architectures": 386493,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 386493
}
}
}