GET /api/protein/UniProt/A0A0G3BRC3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0G3BRC3",
        "id": "A0A0G3BRC3_9BURK",
        "source_organism": {
            "taxId": "413882",
            "scientificName": "Caldimonas brevitalea",
            "fullName": "Caldimonas brevitalea"
        },
        "name": "threonine-phosphate decarboxylase",
        "description": [
            "Decarboxylates L-threonine-O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate, the precursor for the linkage between the nucleotide loop and the corrin ring in cobalamin"
        ],
        "length": 336,
        "sequence": "MPHGADLARARQLYPAPAAGWLDLSTGLNPRPWPVAGELDRVAASVWRDLPDIEADVAQRFERYYGAPALPVPGSQAAIQALPRIWRRLYGTARCHVLAPGYGEHAARWSLEGHTVVACDSQALGQGEPDVIVLARPNNPTGEWFEADTLQALARCCRLLVVDETFLDADVHASVAALREPRVVVLRSLGKFFGLAGLRVGAVLACAPWLDALRAELGPWSVNGPGLHLAAAALADEDWQRDTRDWLAQQAQRLTALLAARGLVSHGTSLFRTVATPAARGLHEGLARRGIWTRLFWLDTPQPFRAVRFGLPANDAGLQRLAQALADVLDKDCESR",
        "proteome": "UP000035352",
        "gene": "cobC1",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
        "counters": {
            "domain_architectures": 344728,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 344728
        }
    }
}