HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0G3BRC3",
"id": "A0A0G3BRC3_9BURK",
"source_organism": {
"taxId": "413882",
"scientificName": "Caldimonas brevitalea",
"fullName": "Caldimonas brevitalea"
},
"name": "threonine-phosphate decarboxylase",
"description": [
"Decarboxylates L-threonine-O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate, the precursor for the linkage between the nucleotide loop and the corrin ring in cobalamin"
],
"length": 336,
"sequence": "MPHGADLARARQLYPAPAAGWLDLSTGLNPRPWPVAGELDRVAASVWRDLPDIEADVAQRFERYYGAPALPVPGSQAAIQALPRIWRRLYGTARCHVLAPGYGEHAARWSLEGHTVVACDSQALGQGEPDVIVLARPNNPTGEWFEADTLQALARCCRLLVVDETFLDADVHASVAALREPRVVVLRSLGKFFGLAGLRVGAVLACAPWLDALRAELGPWSVNGPGLHLAAAALADEDWQRDTRDWLAQQAQRLTALLAARGLVSHGTSLFRTVATPAARGLHEGLARRGIWTRLFWLDTPQPFRAVRFGLPANDAGLQRLAQALADVLDKDCESR",
"proteome": "UP000035352",
"gene": "cobC1",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
"counters": {
"domain_architectures": 344728,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 344728
}
}
}