GET /api/protein/UniProt/A0A0G2Q3I4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0G2Q3I4",
        "id": "A0A0G2Q3I4_SALBC",
        "source_organism": {
            "taxId": "218493",
            "scientificName": "Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)",
            "fullName": "Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)"
        },
        "name": "Cytochrome c-type biogenesis protein CcmE",
        "description": [
            "Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH"
        ],
        "length": 159,
        "sequence": "MNIRRKNRLWIACGILAGLALTLALILYALRSNIDLFYTPGEILYGKRETQQMPETGQRLRVGGMVMPGSVRRDPDSLKVNFSIYDAEGAVTVSYEGILPDLFREGQGVVVQGTLEKGNHIQAQEVLAKHDENYTPPEVEKAMQENHRRPQGVYKDKSS",
        "proteome": null,
        "gene": "ccmE",
        "go_terms": [
            {
                "identifier": "GO:0017003",
                "name": "protein-heme linkage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0017004",
                "name": "cytochrome complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4def072560e09e570e27d0496aff3fe3d453f884",
        "counters": {
            "domain_architectures": 10929,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 4,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10929
        }
    }
}