GET /api/protein/UniProt/A0A0F8KE09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F8KE09",
        "id": "A0A0F8KE09_METMZ",
        "source_organism": {
            "taxId": "2209",
            "scientificName": "Methanosarcina mazei",
            "fullName": "Methanosarcina mazei"
        },
        "name": "Tetrahydromethanopterin S-methyltransferase subunit C",
        "description": [
            "Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step"
        ],
        "length": 267,
        "sequence": "MSAGGAGGEAKGAYPQQTLMALGIVGGLVGIYLGHFMPPAYSFFGGIGAICATVWGADAVRRVASYGLGTGVPSIGMLALGMGILAALFGLALGGIAGPILAVVVAAIIGGVIGALANKVIGMGIPIMEQAMIEISCAGTLVILGLSVVIAGSFDYAAIIENVIANGYIALIFIIGGMGILHPFNACLGPDESQDRTLILAVEKAAIALIITGFASSLHEGLMTAGINILVGLVIWYVAFSKYYALIKRDAYAVVGTGLLPSAEELQ",
        "proteome": "UP000034578",
        "gene": "mtrC",
        "go_terms": [
            {
                "identifier": "GO:0030269",
                "name": "tetrahydromethanopterin S-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015948",
                "name": "methanogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "261b3fd798482c77767d20e457e2547b62471b25",
        "counters": {
            "domain_architectures": 224,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 224
        }
    }
}