General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F7RQX5",
        "id": "A0A0F7RQX5_PYTBI",
        "source_organism": {
            "taxId": "176946",
            "scientificName": "Python bivittatus",
            "fullName": "Python bivittatus (Burmese python)"
        },
        "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase",
        "description": [
            "Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc"
        ],
        "length": 369,
        "sequence": "MGLLVFMRNVLLALCLFLVLGFLYYSAWKLHLLRWEDSSPTKLSEICFCLSEYDKLGFLLKLDSKLPPELASKYGNISEGVCKPGYASALMTAIFPKRFSKPAPMFLDDSFRKWARIRDFLPPFGIKGQDNLIKSVTKNYHLTPALDSLSCRRCVIVGNGGILANKSLGLKIDDYDIVIRLNSAPVKGFEKDVGGKTTMRITYPEGAIQKPEQYEKDSLFVLAGFKWQDFKWLKYIVYKEKVSASDGFWKSVATHVPREPHEIRILNPYFIQEAAFSFIGLPFNNGLMGRGNIPTLGSVAITMVLHNCDEVAVAGFGYDMNSPNAPLHYYENIKMSAIKESWTHNIQREKEFLRKLVKARVITDLTSGI",
        "proteome": "UP000695026",
        "gene": "st3gal3",
        "go_terms": [
            {
                "identifier": "GO:0008373",
                "name": "sialyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009101",
                "name": "glycoprotein biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "539ba3211ecb1f85127c965aa98c3308f6899026",
        "counters": {
            "domain_architectures": 29312,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29312
        }
    }
}