GET /api/protein/UniProt/A0A0F7HC18/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F7HC18",
        "id": "A0A0F7HC18_SERFO",
        "source_organism": {
            "taxId": "47917",
            "scientificName": "Serratia fonticola",
            "fullName": "Serratia fonticola"
        },
        "name": "Signal recognition particle protein",
        "description": [
            "Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY. Interaction with FtsY leads to the transfer of the RNC complex to the Sec translocase for insertion into the membrane, the hydrolysis of GTP by both Ffh and FtsY, and the dissociation of the SRP-FtsY complex into the individual components"
        ],
        "length": 453,
        "sequence": "MFENLTDRLSRTLRNISGRGRLTEENIKETLREVRMALLEADVALPVVRDFINRVKESAVGHEVNKSLTPGQEFVKIVKSELIAAMGEVNTELNLAAQPPAVVLMAGLQGAGKTTSVAKLGKFLKEKQKKKVLVVSADVYRPAAIRQLETLAEGVGIDFFPSDVKEKPIDIVNRALQQAKLKFYDVLIVDTAGRLHVDEAMMDEIKQVHAAIKPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFHPDRVASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLTDFLDQLKQMRNMGGMASMLSKLPGAGQLPDNVKSQMDDKVLVRMEAIINSMTLKERAKPEIIKGSRKRRIAMGSGMQVQDVNRLLKQFDDMQRMMKKMKKGGMAKMMRGMKGMMPPGFPGR",
        "proteome": "UP001235341",
        "gene": "ffh",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008312",
                "name": "7S RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048500",
                "name": "signal recognition particle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3545bf13d1896398eed4c329e7114d163be4ce5",
        "counters": {
            "domain_architectures": 30199,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 3,
                "cathgene3d": 3,
                "pfam": 3,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30199
        }
    }
}