GET /api/protein/UniProt/A0A0F6Q3Q4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F6Q3Q4",
        "id": "A0A0F6Q3Q4_9HYPO",
        "source_organism": {
            "taxId": "115235",
            "scientificName": "Cosmospora coccinea",
            "fullName": "Cosmospora coccinea"
        },
        "name": "Actin",
        "description": [
            "Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells"
        ],
        "length": 163,
        "sequence": "KGGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAIARVDM",
        "proteome": null,
        "gene": "act1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7c3fd5f9f93389082cb00e4f32e34df39e168dec",
        "counters": {
            "domain_architectures": 86462,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 86462
        }
    }
}