GET /api/protein/UniProt/A0A0F3QAN4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0F3QAN4",
"id": "A0A0F3QAN4_ANAPH",
"source_organism": {
"taxId": "1359157",
"scientificName": "Anaplasma phagocytophilum str. CRT53-1",
"fullName": "Anaplasma phagocytophilum str. CRT53-1"
},
"name": "Lysosomal dipeptide transporter MFSD1",
"description": [
"Lysosomal dipeptide uniporter that selectively exports lysine, arginine or histidine-containing dipeptides with a net positive charge from the lysosome lumen into the cytosol. Could play a role in a specific type of protein O-glycosylation indirectly regulating macrophages migration and tissue invasion. Also essential for liver homeostasis"
],
"length": 411,
"sequence": "MRGEGAGLASRGFFAWFLIAMFYALQYVFRVMPNTFSGIIMEKYGVGAFSLGQFSAFYYLGYTAAHIPLGILIDRYGPKRVVPVCMFLTVLGVLPLMFNSWELVQCGRIVTGLGSAAAALSIFKVSNMYFGKRFAIMTSIAMVIGFLGAMYGGMPVLSLTEEHGWKTVLLFLIGSGCALAMLSAFVFYDTQSSQEKSGFIKQIKQVLCNKKLLVISLLGGFMIGSLEGFADGWATAFLTEVCGISYQYASILPSTVFVGSCLGSLAFSFMLNRSVDGFKIIIYCGGFTVLAFGLMLMGHCGTGISAFVLLLIIGISSAYQLVTVCQAISYVGPESVALATAVSNMIIMVFGYFFHTAIAAIVNAYWDGAMSDGHAIYGSDVLVKSMAVVPLGALIGMLGVWIFKLREKQAE",
"proteome": null,
"gene": "APHCRT_0128",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "04ed00d0ac42cc42b19f7796b389c797a27f88ba",
"counters": {
"domain_architectures": 1276664,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1276664
}
}
}