GET /api/protein/UniProt/A0A0F2LLB1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F2LLB1",
        "id": "A0A0F2LLB1_9CREN",
        "source_organism": {
            "taxId": "1326980",
            "scientificName": "Candidatus Aramenus sulfurataquae",
            "fullName": "Candidatus Aramenus sulfurataquae"
        },
        "name": "N5-carboxyaminoimidazole ribonucleotide synthase",
        "description": [
            "Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)(-) to N5-carboxyaminoimidazole ribonucleotide (N5-CAIR)",
            "Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)- to N5-carboxyaminoimidazole ribonucleotide (N5-CAIR)"
        ],
        "length": 362,
        "sequence": "MKSSLPSYKVCILGGGQLGWMMILEGRKLPLTFYVIANPEEPACRVADKCFSEENYKEAINQCDVVTFEFEHVNEEALEYAQESGKLLPKVNSVELKRERYKEKEFLRDHGFPVPRFKVVQDGEEALKVLKDEFNNVGVLKQSRGGYDGKGQYFVKGDPEKYQFLKNVKCKFVVEEFVNFDFEASIIATRGRGEFKAYTPSFNYNEKGILIYNYGPYYNEEMVKIAERLTKELDYIGTMGIEFFVVRNKVLINELAPRVHNTGHYTLDGAFTSQFEQHLRAILGMELGETTVLKPFGMVNIVGRPSFPPEVLKLGKVYWYGKEEARKRRKMGHVNVVGEDLEEVKQKIDKIMQLIYPEGLDL",
        "proteome": null,
        "gene": "purK",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004638",
                "name": "phosphoribosylaminoimidazole carboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006189",
                "name": "'de novo' IMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aeef0530881d5d361cd122529c98f3d4400ebd33",
        "counters": {
            "domain_architectures": 19987,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "profile": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19987
        }
    }
}