GET /api/protein/UniProt/A0A0F1A743/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F1A743",
        "id": "A0A0F1A743_9ENTR",
        "source_organism": {
            "taxId": "2071710",
            "scientificName": "Enterobacter sichuanensis",
            "fullName": "Enterobacter sichuanensis"
        },
        "name": "Small ribosomal subunit protein uS8",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit"
        ],
        "length": 130,
        "sequence": "MSMQDPIADMLTRIRNGQAANKVAVTMPSAKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKKKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA",
        "proteome": "UP000787201",
        "gene": "rpsH",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a4747c6a798d7281dd053851293bd2cdfb8fafc8",
        "counters": {
            "domain_architectures": 48940,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 48940
        }
    }
}