General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0E4ADC2",
        "id": "A0A0E4ADC2_RHOER",
        "source_organism": {
            "taxId": "1833",
            "scientificName": "Rhodococcus erythropolis",
            "fullName": "Rhodococcus erythropolis"
        },
        "name": "DNA integrity scanning protein DisA",
        "description": [
            "Has also diadenylate cyclase activity, catalyzing the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP likely acts as a signaling molecule that may couple DNA integrity with a cellular process",
            "Participates in a DNA-damage check-point. DisA forms globular foci that rapidly scan along the chromosomes searching for lesions"
        ],
        "length": 361,
        "sequence": "MADTQSSSALRETIARLAPGTALRDGLERILRGRTGALIVLGYDEEMEALCDGGFNLDVEFAPTRLRELSKMDGAVVLSTDGTRIVRANVQLVPDHKIPTVESGTRHRAAERTAIQTGYPVVSVSQSMSIVSVYVGGIRHVIDGSATILSRANQAVATLERYKARLDEVTRQLSVVEIEDFVTLRDALTVVQRLEMVRRVSIEIEQDVLELGTDGRQLALQLEELVGDNDIARQLIVRDYLAGPEPIGTAAMDNVLVALDRVTDADLLDLTTLARVLGYPGTIEALDTPMTPRGYRVLMRVPRLQFHQIHRLVGSFGTLQSLLAATAADLQSVEGIGGLWARHIREGLSRLAETSITGSFN",
        "proteome": "UP000627573",
        "gene": "disA",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e22148035d601fa67864b050a1d4ab9be92b5044",
        "counters": {
            "domain_architectures": 2885,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "profile": 1,
                "ssf": 2,
                "pfam": 2,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2885
        }
    }
}