General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0E1WYM8",
        "id": "A0A0E1WYM8_9HYPH",
        "source_organism": {
            "taxId": "520462",
            "scientificName": "Brucella pinnipedialis M292/94/1",
            "fullName": "Brucella pinnipedialis M292/94/1"
        },
        "name": "Lectin-like protein BA14k",
        "description": [
            "Has immunoglobulin-binding and hemagglutination properties, and can bind to mannose. Essential for virulence. May be involved in LPS biosynthesis or polysaccharide transport"
        ],
        "length": 166,
        "sequence": "MLKSLKKVMVGMLGATFLISALAPVSAAPTMLSAPAVANENLQQVRDHRWGGGDRHWGGHRPGYRPGWQGRPGYWNGHRGYRYYRHGYRRHSDGWWYPLAAFGAGAIIGGALAAPPPPPPPVYPAPAYRYSNAHIQWCYNRYKSYRASDNTFQPYNGPRQQCYSPY",
        "proteome": null,
        "gene": "BALG_02344",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "00f57a69cd770a6a273e64af2d455d1d60ceb6fc",
        "counters": {
            "domain_architectures": 3451,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3451
        }
    }
}