GET /api/protein/UniProt/A0A0E1NGI4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0E1NGI4",
        "id": "A0A0E1NGI4_YEREN",
        "source_organism": {
            "taxId": "630",
            "scientificName": "Yersinia enterocolitica",
            "fullName": "Yersinia enterocolitica"
        },
        "name": "Glyoxylate/hydroxypyruvate reductase A",
        "description": [
            "Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively"
        ],
        "length": 313,
        "sequence": "MNIIFYHPFFEAKQWLSGLQSRLPTANIRQWRRGDTQPADYALVWQPPQEMLASRVELKGVFALGAGVDAILDQERRHPGTLPAGVPLVRLEDTGMSLQMQEYVVATVLRYFRRMDEYQLQQQQKLWQPLEPHQHDKFTIGILGAGVLGKSVAHKLAEFGFTVRCWSRTPKQIDGVTSFAGQEKLPAFIQGTQLLINLLPHTPQTAGILNQSLFSQLNANAYIINIARGAHLLERDLLAAMNAGQVAAATLDVFAEEPLPSMHPFWSHPRVTITPHIAAVTLPEVAMDQVVANIQAMEAGREPVGLVDVVRGY",
        "proteome": null,
        "gene": "ghrA",
        "go_terms": [
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016618",
                "name": "hydroxypyruvate reductase [NAD(P)H] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030267",
                "name": "glyoxylate reductase (NADPH) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e947ae83d5e04cc3fe2c0685a42589c00bed270d",
        "counters": {
            "domain_architectures": 31722,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 31722
        }
    }
}