HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D6H666",
"id": "A0A0D6H666_STAAU",
"source_organism": {
"taxId": "1280",
"scientificName": "Staphylococcus aureus",
"fullName": "Staphylococcus aureus"
},
"name": "Shikimate dehydrogenase (NADP(+))",
"description": [
"Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA)"
],
"length": 268,
"sequence": "MKFAVIGNPISHSLSPVMHRANFNSLGLDDTYEALNIPIEDFHLIKEIISKKELEGFNITIPHKERIIPYLDYVDEQAINAGAVNTVLIKDGKWIGYNTDGIGYVKGLHSVYPDLENAYILILGAGGASKGIAYELAKFVKPKLTVANRTMARFESWNLNINQISLADAEKYLAEFDIVINTTPAGMAGNNESIINLKHLSPNTLMSDIVYIPYKTPILEEAERKGNHIYNGLDMFVYQGAESFKIWTNKDADINSMKTAVLQQLKGE",
"proteome": null,
"gene": "aroE",
"go_terms": [
{
"identifier": "GO:0004764",
"name": "shikimate 3-dehydrogenase (NADP+) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019632",
"name": "shikimate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27f73ccca551f481719533ba9853869fec77f542",
"counters": {
"domain_architectures": 13771,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 3,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13771
}
}
}