HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D6H241",
"id": "A0A0D6H241_ALCXX",
"source_organism": {
"taxId": "85698",
"scientificName": "Alcaligenes xylosoxydans xylosoxydans",
"fullName": "Alcaligenes xylosoxydans xylosoxydans"
},
"name": "Nucleoside diphosphate kinase",
"description": [
"Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate"
],
"length": 141,
"sequence": "MSVQRTLSIIKPDAVAKNVIGQIVARFEQAGLKVIAARLAQLSRADAERFYAVHKERPFFKDLVDFMVSGPVFVQVLEGEDAIQKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSDAPETAAVEVAFFFPEINIHSR",
"proteome": null,
"gene": "ndk",
"go_terms": [
{
"identifier": "GO:0004550",
"name": "nucleoside diphosphate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006183",
"name": "GTP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006228",
"name": "UTP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006241",
"name": "CTP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cac8064c040caff7c196d0f0b27a2c0d5516558b",
"counters": {
"domain_architectures": 37588,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"profile": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 37588
}
}
}