General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D5C3Z9",
        "id": "A0A0D5C3Z9_9ARCH",
        "source_organism": {
            "taxId": "1580092",
            "scientificName": "Nitrosopumilus adriaticus",
            "fullName": "Nitrosopumilus adriaticus"
        },
        "name": "Exosome complex component Rrp4",
        "description": [
            "Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Confers strong poly(A) specificity to the exosome"
        ],
        "length": 226,
        "sequence": "MDNKRKYVIPGDVVTTGPFRPEQNVELQGNKIISTTIGISEIYDDSVKVIPLTGKYIPKINDLVIGKVISHTSLSWELDINSCYVGFLPAQDVFGRDFSAHADELSSKLKSGDLVAARIANFDRTRDPLVTISDRDLGKIDTGDLVKISPSKVPRLIGKRGTMIQMIEMATDAAITIGQNGWVVVSCESPEGLLKAKKAIEMVNEKAHVANLTDQVKEMLESKGES",
        "proteome": "UP000032408",
        "gene": "rrp",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008143",
                "name": "poly(A) binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000178",
                "name": "exosome (RNase complex)",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ddddc275d4d8e739aa57b61e3683d0185851d793",
        "counters": {
            "domain_architectures": 42,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 2,
                "cdd": 2,
                "smart": 2,
                "profile": 2,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 42
        }
    }
}