GET /api/protein/UniProt/A0A0D3M6A6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D3M6A6",
        "id": "A0A0D3M6A6_9ASPA",
        "source_organism": {
            "taxId": "1498489",
            "scientificName": "Habenaria pantlingiana",
            "fullName": "Habenaria pantlingiana"
        },
        "name": "NAD(P)H-quinone oxidoreductase subunit H, chloroplastic",
        "description": [
            "NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient"
        ],
        "length": 393,
        "sequence": "MTIPATRKNFIIINMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITVNAPERLESVQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFREREFIYDLFEAATGMRMMHNYFRIGGVAADLPYGWIDKCFDFCDYFLTEVVEYKKLITRNPIFLERVEGVGIISGEETINWGLSGPMLRASGVQWDLRKVDRYECYNKFDWEVKWQKEGDTLARYLVRIGEMEESIKIIQQALEGIPGGPYENLETRRFYTTKNSEWNNFEYRFLTKKLSPNFELLKQELYVRVESPKGELGIYLIGDSSVFPWRWKIRPPGFINLQILPQLVKRMKLADIMTILGSIDIIMGEVDR",
        "proteome": null,
        "gene": "ndhH",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10402606fa10b66bf9d99416e3ef252c18ea9acd",
        "counters": {
            "domain_architectures": 33063,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33063
        }
    }
}