General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D2XC71",
        "id": "A0A0D2XC71_FUSOF",
        "source_organism": {
            "taxId": "660025",
            "scientificName": "Fusarium oxysporum (strain Fo5176)",
            "fullName": "Fusarium oxysporum (strain Fo5176) (Fusarium vascular wilt)"
        },
        "name": "rRNA biogenesis protein RRP36",
        "description": [
            "Component of the 90S pre-ribosome involved in the maturation of rRNAs. Required for early cleavages of the pre-RNAs in the 40S ribosomal subunit maturation pathway"
        ],
        "length": 318,
        "sequence": "MAFKRKTSSSFGLERRVRPRREDEWVEEPESQGSSSEDDDEVEEEGIRGVSDDDDDDDDDDEGEEDQESEEGSEDESEPEQDTPKIDLSSVSFGALAKAQASLPSAGRKSKSKKSTDEDASKTETPAPRKSTKSKDDPKPKRSSKHAPQEQTSKKPVSRRREILPDNRRQYRDPRFDPLVGRVDEEKASKAYAFLDEYRDKEMADLRAQIKKTKDSYEKDNLKRQLQSMESRKKANMRRQEEERLLKDHRQKEKELVAQGKTPFYLKKSEQKKQLLVNRYEGMSKGQVDRAIERKRKKVAGKEKKELDFLQRGSRPRG",
        "proteome": null,
        "gene": "28943740",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4ba46bb20216e344a3a4efd4ba52ccd09b2bc16d",
        "counters": {
            "domain_architectures": 4268,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4268
        }
    }
}