HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D2GPL8",
"id": "A0A0D2GPL8_9BACT",
"source_organism": {
"taxId": "1306947",
"scientificName": "candidate division TM6 bacterium JCVI TM6SC1",
"fullName": "candidate division TM6 bacterium JCVI TM6SC1"
},
"name": "Methionine aminopeptidase",
"description": [
"Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed"
],
"length": 253,
"sequence": "MITIKNRASIAKMHEAGQRLAHIFQELPSRLMPGISTLDIDSWISLEIKKNHLVSKMLGYSGYGHVSCISINDEVVHGVPHKVKCLSDGDLVKIDVCVAYKGYCADMARSFFVGQTSDHTAKRLVEITALSLDKGIEQARAGNRLGDVSAAIGHTIESAGFGIVRDFAGHGIGKRMHEDPEVLNYGIPGKGPLLQVGMAFAIEPMVTVGHYDVYITEDNWTVKTTDKSLAAHVEDTVVITQDGPLVITRIDNK",
"proteome": "UP000032214",
"gene": "map",
"go_terms": [
{
"identifier": "GO:0070006",
"name": "metalloaminopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b3f357c661ba295d4df0c6b55962d5d621766ffe",
"counters": {
"domain_architectures": 70904,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 70904
}
}
}