General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D2FSQ0",
        "id": "A0A0D2FSQ0_CLAB1",
        "source_organism": {
            "taxId": "1442370",
            "scientificName": "Cladophialophora bantiana (strain ATCC 10958 / CBS 173.52 / CDC B-1940 / NIH 8579)",
            "fullName": "Cladophialophora bantiana (strain ATCC 10958 / CBS 173.52 / CDC B-1940 / NIH 8579)"
        },
        "name": "Multiprotein-bridging factor 1",
        "description": [
            "Transcriptional coactivator that stimulates GCN4-dependent transcriptional activity by bridging the DNA-binding region of GCN4 and TBP (SPT15), thereby recruiting TBP to GCN4-bound promoters. Involved in induction of the ribosome quality control (RQC) pathway; a pathway that degrades nascent peptide chains during problematic translation. Required to prevent stalled ribosomes from frameshifting"
        ],
        "length": 165,
        "sequence": "MADSDWDTVTRIGSKVRGPGSGAVDRERVVKGNSALNAAKRSGAVVLTEKKYGGTNSRSGAEGQHLTKVDRSDDIIKPKTIPPAVSRAIAEWRNQNKGPDGKAMKQIDLADKAHVDRTLLRDIESGKAAYDSVALGKLEKTMHINLLGGDIGSPKGPKFKRQQQK",
        "proteome": "UP000053789",
        "gene": "Z519_09738",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a579fe056eb18cde8c0d758d879604e6516ad909",
        "counters": {
            "domain_architectures": 347,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 347
        }
    }
}