GET /api/protein/UniProt/A0A0D2DRW4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D2DRW4",
"id": "A0A0D2DRW4_9EURO",
"source_organism": {
"taxId": "215243",
"scientificName": "Exophiala oligosperma",
"fullName": "Exophiala oligosperma"
},
"name": "Nuclear distribution protein PAC1",
"description": [
"Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for nuclear migration during vegetative growth as well as development. Required for retrograde early endosome (EE) transport from the hyphal tip. Required for localization of dynein to the mitotic spindle poles. Recruits additional proteins to the dynein complex at SPBs"
],
"length": 457,
"sequence": "MSQLLTARQAEELHKSMVAYLISVGMNDSAVALRRESNLPDSFDDATAKKYETLLEKKWTSVVRLQKKIMDLEAKNTALQHEIDTATPLSSNRKIDPVTWLPRSPARHTLQGHRLPVTSVAFHPIFSSLASASEDSTIKIWDWELGELERTLKGHTKAVLDVDFGGPRGGTLLASCSSDLTIRLWDPSDEYKNIRTLPGHDHSISCIRFIPSGAAGAPLSGNTLVSASRDKTLRIWDVTTGYCLKTLKGHTDWVRAVTPSIDGRFLLSAGNDQIPRLWDANSGEVKITFLGHEHVVECVAFAPSTSYVHLSGIAGYKKPPPVGSSGEFLATGGRDKIIKIWDNRGTCHKTLVGHDNWVRGLVFHPGGRYLLSISDDKTIRCWDLSQECKCVKVVDESHQHFISSIRWAPDVPGQPMTNGDSNGVSTTTKKEDGVGGGKIRCVIATASVDLNVRVFAG",
"proteome": "UP000053342",
"gene": "PAC1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b30198e9e61dce0cfe3609cbf81f72ff566da37",
"counters": {
"domain_architectures": 1301,
"entries": 26,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"profile": 3,
"smart": 1,
"cdd": 1,
"pirsf": 1,
"hamap": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1301
}
}
}