HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0D2ABV7",
"id": "A0A0D2ABV7_9EURO",
"source_organism": {
"taxId": "569365",
"scientificName": "Cladophialophora immunda",
"fullName": "Cladophialophora immunda"
},
"name": "D-xylulose reductase",
"description": [
"Xylitol dehydrogenase which catalyzes the conversion of xylitol to D-xylulose. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway"
],
"length": 366,
"sequence": "MAYSNPSVFLYGPGQAKIQDRPEPKITDATDAIIRIKFVGVCGSDVHFWNHGGVNGKFVSESNPLVMGHEASGTVHAVGSAVTHLRPGDNVAIEPGQPCRSCDRCKEGLYNLCPHMKFAACPPDTPGCLTKYFKIPADFCYKLPPGVSLQEGVLAEPLAVAAHAVRMIGVKPGQSLVIFGAGTIGLVCGAVARLFGAKKVVAVDLLDHKLEFARNLNRSNTFKPDLSASPEKNAARLIEENGLGLGADAVIEATGAESSIITAVHVLRPGGSCVQTGLGKPVINFPILAMSEKELHMHGAFRYNEGDFKVAMDVLEAGTLPLKSLISNIFDFEHTTDAWEATKQGRGIKNMIRGYGYRDPARISHL",
"proteome": "UP000054466",
"gene": "PV07_12180",
"go_terms": [
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
"counters": {
"domain_architectures": 323634,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"smart": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 323634
}
}
}