General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D1Z0V1",
        "id": "A0A0D1Z0V1_9EURO",
        "source_organism": {
            "taxId": "1016849",
            "scientificName": "Exophiala sideris",
            "fullName": "Exophiala sideris"
        },
        "name": "Histone acetyltransferase type B catalytic subunit",
        "description": [
            "Catalytic component of the histone acetylase B (HAT-B) complex. Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Involved in DNA double-strand break repair"
        ],
        "length": 490,
        "sequence": "MAALSEEYSVNANDAVHVAIVQPGPNDKLTTRHDFHPKFTYPIVGEAEQIFGYKGLDVEIRFAAHDLRPHVKISHQKKFNTIGSTSALDLNKKLGEFLPPIAFEQGFDQEVQNDAKAATWTPPGTLVKKYTRGGQQYEVWAGSLLNMAMRTLVDNIQILIVFFIEGGQFINLEDPDWTLDRWRVYLTYHKSAQPPTPTASPYSFVGYATTYRFYKIQKPKEHQSSFTFPSSEMITPTKLPSRLRLSQFLITPPYQSAGHGSALYQAVYEEVMADPTIFEMTVEDPSEEFDKLRDMNDFDVLRPQFDAVDLKIDTSPFTTVERGRLKLVPTAKLLPLEKLQEIRAKNKIASRQFARMVEMYLLAEIPLQHRSLGGASLTSLKIRGARAPNPHDRSYYWWRLLLKQRIMKKNEDILQQVPLEERLPQIEDSARGQEDEYEGLIYTYAMRRAKEADRHGNGEASATVRKRKIVDSDDEDEPEEPNGASKRAKV",
        "proteome": null,
        "gene": "PV11_08031",
        "go_terms": [
            {
                "identifier": "GO:0006325",
                "name": "chromatin organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042393",
                "name": "histone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004402",
                "name": "histone acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031509",
                "name": "subtelomeric heterochromatin formation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "411a8055f66abcf59d2f9253dbaec32d63851750",
        "counters": {
            "domain_architectures": 764,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 2,
                "cathgene3d": 3,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 764
        }
    }
}