General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D1WVM7",
        "id": "A0A0D1WVM7_EXOME",
        "source_organism": {
            "taxId": "212818",
            "scientificName": "Exophiala mesophila",
            "fullName": "Exophiala mesophila (Black yeast-like fungus)"
        },
        "name": "V-type proton ATPase subunit H",
        "description": [
            "Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments"
        ],
        "length": 478,
        "sequence": "MSLSPPAYLSSLQSNIRARPIPWDGAVRAGNLTEDHLKKIKSVDKVRKDQRKQTIEKDVQSYSALLVGGGSEPSVLEKAAKRGDILQYILVLATDLINDAPELATAILKLPDPYKGFLSLLSHSNNPEDPIPLFAATFLVNLISISLTTSPKPASRDDKALPLVYSYLSKLVKNQDSGLQDIGVQHTSQLLRTQQAKELFWKQRSDTVDPLFDILRKAVGAAKDNDSSLWSGNASIRSSDTRLGGGVGLQLLYHCLLVIWQLSFEGELVGEGLEADEEIVPLYIQLLRVSPKEKTTRLLLATLNNLLSSNQETLIPTATTARLPALLSNLSGRHLTDPDLLEDLEALKALLEEYTRNQTTFDEYADEVNSGHLRWSPPHRNPTFWRENARKILEEKKGELPKKLAEIMAKPWDNDKKVLAIGCNDLGHLVKEVPEYRSRLEKLGLKARLLELMGDSDENVRWESLKAVGEWLRYTSDR",
        "proteome": "UP000054302",
        "gene": "PV10_04628",
        "go_terms": [
            {
                "identifier": "GO:0046961",
                "name": "proton-transporting ATPase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000221",
                "name": "vacuolar proton-transporting V-type ATPase, V1 domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "710f75c48e95a31c6aa128560e2a5657f5a966b2",
        "counters": {
            "domain_architectures": 5098,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5098
        }
    }
}