General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0D1DNW0",
        "id": "A0A0D1DNW0_MYCMD",
        "source_organism": {
            "taxId": "5270",
            "scientificName": "Mycosarcoma maydis",
            "fullName": "Mycosarcoma maydis (Corn smut fungus)"
        },
        "name": "ATP synthase subunit d, mitochondrial",
        "description": [
            "Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation"
        ],
        "length": 170,
        "sequence": "MAARAAAVDLAKISNLGLGKNTLAQISAFRKRADDAKRQLAQLKQQNTDIDFAHYSNVLRNKDVVSQAQKILSEFKPVTYDVQAQLKAIDAFESKAVEQAQATASKIEAELKDLKATLKNIEDARPFDQLTVDDVVAARPEIGRTVDEMVKKGKWTTPGYDEKFGNLSAI",
        "proteome": "UP000000561",
        "gene": "UMAG_12050",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "43895c4b4947eb573a72e4a97fc764625b9affb8",
        "counters": {
            "domain_architectures": 4550,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4550
        }
    }
}