General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0C7DWG2",
        "id": "A0A0C7DWG2_9MAGN",
        "source_organism": {
            "taxId": "23283",
            "scientificName": "Ribes aureum",
            "fullName": "Ribes aureum (golden currant)"
        },
        "name": "Chalcone-flavonone isomerase family protein",
        "description": [
            "Catalyzes the intramolecular cyclization of bicyclic chalcones into tricyclic (S)-flavanones. Responsible for the isomerization of 4,2',4',6'-tetrahydroxychalcone (also termed chalcone) into naringenin"
        ],
        "length": 182,
        "sequence": "VRGLDIQGKFMKFTAIGVYLEDSAVTSLAVKWNGKSAEELTESVEFFRDIVTGPYEKFIQVTTILPLTGQQYSEKVAENCVAFWKSVGIYTDAEAKAVEKFLEIFKDENFPPGASILFTQSPLGSLTIAFSKDMCIPEVGNAVIENKLLSEAVLESIIGKHGVSPTAKQSLAARISELVKGQ",
        "proteome": null,
        "gene": "CHI",
        "go_terms": [
            {
                "identifier": "GO:0016872",
                "name": "intramolecular lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045430",
                "name": "chalcone isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009813",
                "name": "flavonoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a57c2db5c9b31812072fff4965513e3df1dc8e59",
        "counters": {
            "domain_architectures": 2834,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2834
        }
    }
}