GET /api/protein/UniProt/A0A0C1QWX2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0C1QWX2",
        "id": "A0A0C1QWX2_9CLOT",
        "source_organism": {
            "taxId": "1418104",
            "scientificName": "Clostridium argentinense CDC 2741",
            "fullName": "Clostridium argentinense CDC 2741"
        },
        "name": "Pyridoxal 5'-phosphate synthase subunit PdxS",
        "description": [
            "Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively"
        ],
        "length": 291,
        "sequence": "MTQERYELNKNLAQMLKGGVIMDVTTPEQAKIAEAAGACSVMALERIPADIRAAGGVSRMSDPAMIRSIQEAVSIPVMAKVRIGHFAEAQILQAIEIDYIDESEVLSPADDIYHIDKKQFNVPFVCGAKDLGEALRRINEGASMIRTKGEPGTGDIIQAVRHMRKIMSDIRAIASKRDDELYLVAKELAVPYELVKYVHENEKLPVVNFAAGGIATPADAALMMQLGAEGVFVGSGIFKSGNPEKRAAAIVKAVTNYKDANLIAKLSENLGEAMVGINEQEIELLMAERGQ",
        "proteome": "UP000031366",
        "gene": "pdxS",
        "go_terms": [
            {
                "identifier": "GO:0042819",
                "name": "vitamin B6 biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042823",
                "name": "pyridoxal phosphate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0af229986cfdd8be03a4990670a18fd59ceb002f",
        "counters": {
            "domain_architectures": 13010,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13010
        }
    }
}