GET /api/protein/UniProt/A0A0C1KJT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0C1KJT8",
        "id": "A0A0C1KJT8_STRCV",
        "source_organism": {
            "taxId": "76860",
            "scientificName": "Streptococcus constellatus",
            "fullName": "Streptococcus constellatus"
        },
        "name": "Translation initiation factor IF-3",
        "description": [
            "IF-3 binds to the 30S ribosomal subunit and shifts the equilibrium between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins"
        ],
        "length": 176,
        "sequence": "MKTIAKQDLFINDEIRVREVRLIGLDGEQLGIKPLSEAQAIADDANVDLVLIQPQAKPPVAKIMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPTIDKGDFDTKLRNARKFLEKGNKVKVSIRFKGRMITHKEIGAKVLADFAQATQDIAIIEQRAKMDGRQMFMQLAPIPDKK",
        "proteome": null,
        "gene": "infC",
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0c9cb4d3ca1084faa12bc81ad6b09c7b36fd1fe0",
        "counters": {
            "domain_architectures": 26296,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26296
        }
    }
}