General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0B6YR32",
        "id": "A0A0B6YR32_9EUPU",
        "source_organism": {
            "taxId": "1028688",
            "scientificName": "Arion vulgaris",
            "fullName": "Arion vulgaris"
        },
        "name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]",
        "description": [
            "Catalyzes the NAD-dependent dehydrogenation (oxidation) of a broad array of hydroxylated polyunsaturated fatty acids (mainly eicosanoids and docosanoids, including prostaglandins, lipoxins and resolvins), yielding their corresponding keto (oxo) metabolites. Decreases the levels of the pro-proliferative prostaglandins such as prostaglandin E2 (whose activity is increased in cancer because of an increase in the expression of cyclooxygenase 2) and generates oxo-fatty acid products that can profoundly influence cell function by abrogating pro-inflammatory cytokine expression. Converts resolvins E1, D1 and D2 to their oxo products, which represents a mode of resolvin inactivation. Resolvin E1 plays important roles during the resolution phase of acute inflammation, while resolvins D1 and D2 have a unique role in obesity-induced adipose inflammation"
        ],
        "length": 206,
        "sequence": "FVSSESEYNRTELSASATLRMSLSGKAAIVTGAAQGLGKAFSEVMLQNGAKVALTDYSSDHGLKTLAEFQTKYGENKVMFMKCDVTSKEEMAETFQTVKERFGGLDIVINNAGVGFEMGDLWEKTVDVNLKGTIRGTILGIEHMRRDNGGHGGVIVTFLQWQESIPIHVDQSMEQLKVLSSCTLKLGRKIQSYLLMESVSMFLHHR",
        "proteome": null,
        "gene": "ORF31393",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
        "counters": {
            "domain_architectures": 599639,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 599639
        }
    }
}