GET /api/protein/UniProt/A0A0B5GJF5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0B5GJF5",
        "id": "A0A0B5GJF5_9SPHN",
        "source_organism": {
            "taxId": "1586240",
            "scientificName": "Sphingopyxis sp. SE2",
            "fullName": "Sphingopyxis sp. SE2"
        },
        "name": "Mercuric reductase",
        "description": null,
        "length": 472,
        "sequence": "MNDCCNRPGQEGFDVAVIGAGSAGFSAAIAAADLGAKVALVGHGTIGGTCVNVGCVPSKTLIRAAEAVHGGLAAARFPGLGGAVQMDDWSVLAASKDDLVTTLRQKKYVDLLPAYEGVSYIEGKARFADGALIVGDAPMKVGKVILAMGAHAAVPPIPGMDSVPYLTSTSALALDRLPKSLLVIGGGVIGVELGQMFSRLGVDVTICCRSRLLPEMDPEVSAALKNYLEAEGVRVCAGVGYQRIAQTQSGVELTREGHCDTVAAEQVLIATGRRPNSDGLGLEERGIVLARNGGIVVDDHLETSVPGIYAAGDVTGRDQFVYMAAYGAKLAARNAVTGNQYRYDNSSMPSVVFTDPQVASAGLTETTARAQGLDIKVSLLPLDAVPRALAARDTRGLIKLIADKANDRLLGGQIMAPEGADSIQTLVLAIKHGMTTLELGATIFPYLTTVEGLKLAAQTFDKDVAKLSCCAG",
        "proteome": null,
        "gene": "merA",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016152",
                "name": "mercury (II) reductase (NADP+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045340",
                "name": "mercury ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050787",
                "name": "detoxification of mercury ion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016668",
                "name": "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "786e6e0af388e0b289d71a3e92e80414d4c849c2",
        "counters": {
            "domain_architectures": 105347,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 105347
        }
    }
}