HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0B5GJF5",
"id": "A0A0B5GJF5_9SPHN",
"source_organism": {
"taxId": "1586240",
"scientificName": "Sphingopyxis sp. SE2",
"fullName": "Sphingopyxis sp. SE2"
},
"name": "Mercuric reductase",
"description": null,
"length": 472,
"sequence": "MNDCCNRPGQEGFDVAVIGAGSAGFSAAIAAADLGAKVALVGHGTIGGTCVNVGCVPSKTLIRAAEAVHGGLAAARFPGLGGAVQMDDWSVLAASKDDLVTTLRQKKYVDLLPAYEGVSYIEGKARFADGALIVGDAPMKVGKVILAMGAHAAVPPIPGMDSVPYLTSTSALALDRLPKSLLVIGGGVIGVELGQMFSRLGVDVTICCRSRLLPEMDPEVSAALKNYLEAEGVRVCAGVGYQRIAQTQSGVELTREGHCDTVAAEQVLIATGRRPNSDGLGLEERGIVLARNGGIVVDDHLETSVPGIYAAGDVTGRDQFVYMAAYGAKLAARNAVTGNQYRYDNSSMPSVVFTDPQVASAGLTETTARAQGLDIKVSLLPLDAVPRALAARDTRGLIKLIADKANDRLLGGQIMAPEGADSIQTLVLAIKHGMTTLELGATIFPYLTTVEGLKLAAQTFDKDVAKLSCCAG",
"proteome": null,
"gene": "merA",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016152",
"name": "mercury (II) reductase (NADP+) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045340",
"name": "mercury ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050787",
"name": "detoxification of mercury ion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016668",
"name": "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "786e6e0af388e0b289d71a3e92e80414d4c849c2",
"counters": {
"domain_architectures": 105347,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 2,
"cathgene3d": 2,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 2,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 105347
}
}
}