HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0B5DPI5",
"id": "A0A0B5DPI5_9ACTN",
"source_organism": {
"taxId": "40318",
"scientificName": "Streptomyces nodosus",
"fullName": "Streptomyces nodosus"
},
"name": "Magnesium and cobalt transport protein CorA",
"description": [
"Mediates influx of magnesium ions. Alternates between open and closed states. Activated by low cytoplasmic Mg(2+) levels. Inactive when cytoplasmic Mg(2+) levels are high"
],
"length": 371,
"sequence": "MSMIRDLRAAVRPSRPAPRKESGTYDTTRDPATPSAVVDCAVYRDGERVETQKPLSPHEAMRLVRRDGGFVWMGLHEPTEAEFAGIAGEFGLHPLAVEDAVQAHQRPKLERYDDSLFTVFKTIHYVDHDHLPANSEVVETGEVMCFTGRDFFITVRHGGQGSLRALRHRLQDDPELLAKGPSAVLHAIADHVVDGYIAVADALQDDIDEVETEVFSPDRKGTPRGTDASRIYQLKREVLAFKRAVAPLLRPMLLLSERPMRLIDPDIQKYFRDVADHLARIHEQVVGFDELLNSILQANLAQASVAQNEDMRKITAWAAIIAVPTMVCGVYGMNFQNMPEVHWKYGYPVIMSVTVAICLGIHRTLKRNGWL",
"proteome": "UP000031526",
"gene": "SNOD_21795",
"go_terms": [
{
"identifier": "GO:0046873",
"name": "metal ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030001",
"name": "metal ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8ae119ef7d6edfbd5df8188d67891b085e935e05",
"counters": {
"domain_architectures": 54851,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 54851
}
}
}