General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0B5CWE9",
        "id": "A0A0B5CWE9_9GEMI",
        "source_organism": {
            "taxId": "391228",
            "scientificName": "Beet curly top Iran virus",
            "fullName": "Beet curly top Iran virus"
        },
        "name": "Capsid protein",
        "description": [
            "Binds the genomic viral ssDNA and shuttles it into and out of the cell nucleus",
            "Encapsidates the viral genome into characteristic twinned ('geminate') particles. Binds the genomic viral ssDNA and shuttles it into and out of the cell nucleus. Plays a role in protection of the genome from degradation, virus acquisition and transmission by insect vectors, infectivity, and systemic movement. The CP of monopartite geminiviruses is absolutely essential for virus movement",
            "Encapsidates the viral genome into characteristic twinned ('geminate') particles. Plays a role in protection of the genome from degradation, virus acquisition and transmission by insect vectors, infectivity, and systemic movement. The CP of monopartite geminiviruses is absolutely essential for virus movement"
        ],
        "length": 224,
        "sequence": "MAVQESKRKYTPPASWTRKRKTTGGRTVSKKYQWKRPVRSNRAVKLKMYDDMLGASGVGSTISNDGMITMLNNYVQGIGDSQRSNNLTVTRHLKFDMSLMASGAFWASPNYMTQYHWVIVDRDVGSTFPTQLSTIFDIPTGGQAMPSTYRIRRDANERFIVKKKWQTHLMSTGTDYGGKQTYKAPSMPNYKNSMNINIRNINVKTLWKDTGGGKYEDVKENAIL",
        "proteome": null,
        "gene": "V1",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "752baa0bf3b63ded923c537922c07a0479adf322",
        "counters": {
            "domain_architectures": 9485,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9485
        }
    }
}