GET /api/protein/UniProt/A0A0B2QC78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0B2QC78",
"id": "A0A0B2QC78_GLYSO",
"source_organism": {
"taxId": "3848",
"scientificName": "Glycine soja",
"fullName": "Glycine soja (Wild soybean)"
},
"name": "Probable magnesium transporter",
"description": [
"Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+) but to a much less extent than Mg(2+)"
],
"length": 344,
"sequence": "MSSSNLTGFVLAVLSSAFIGSSFIIKKKGLQLASANGPRASVGGYGYLLQPLWWVGMITMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFLLKEKLQKMGMLGCLLCIVGSTVIVLHAPEEKSLSSVQEIWELAIQPAFLSYTASAIAVTLFLVLYCAPRHGQTNILVYTGICSIVGSLTVMSVKAVGIAIKLTLEGANQAFHFQAWVFAMVSVTCIIVQLNYLNMALDNFNTAVVSPIYYALFTSFTILASAIMFKDYSGQSISSIASELCGFITILSGTTILHSTREPDPPVVADLYTPLSPKVSWYIQGNSEPWKQEEDVSPLNLIAIIRQDHFK",
"proteome": "UP000289340",
"gene": "glysoja_026960",
"go_terms": [
{
"identifier": "GO:0015095",
"name": "magnesium ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015693",
"name": "magnesium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "061b4e8eb9aa91047fd39daf2ec92d67edd68407",
"counters": {
"domain_architectures": 22102,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22102
}
}
}