GET /api/protein/UniProt/A0A0B2QC78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0B2QC78",
        "id": "A0A0B2QC78_GLYSO",
        "source_organism": {
            "taxId": "3848",
            "scientificName": "Glycine soja",
            "fullName": "Glycine soja (Wild soybean)"
        },
        "name": "Probable magnesium transporter",
        "description": [
            "Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+) but to a much less extent than Mg(2+)"
        ],
        "length": 344,
        "sequence": "MSSSNLTGFVLAVLSSAFIGSSFIIKKKGLQLASANGPRASVGGYGYLLQPLWWVGMITMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFLLKEKLQKMGMLGCLLCIVGSTVIVLHAPEEKSLSSVQEIWELAIQPAFLSYTASAIAVTLFLVLYCAPRHGQTNILVYTGICSIVGSLTVMSVKAVGIAIKLTLEGANQAFHFQAWVFAMVSVTCIIVQLNYLNMALDNFNTAVVSPIYYALFTSFTILASAIMFKDYSGQSISSIASELCGFITILSGTTILHSTREPDPPVVADLYTPLSPKVSWYIQGNSEPWKQEEDVSPLNLIAIIRQDHFK",
        "proteome": "UP000289340",
        "gene": "glysoja_026960",
        "go_terms": [
            {
                "identifier": "GO:0015095",
                "name": "magnesium ion transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015693",
                "name": "magnesium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "061b4e8eb9aa91047fd39daf2ec92d67edd68407",
        "counters": {
            "domain_architectures": 22102,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22102
        }
    }
}