GET /api/protein/UniProt/A0A0A6Z8F6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0A6Z8F6",
        "id": "A0A0A6Z8F6_9SPER",
        "source_organism": {
            "taxId": "707766",
            "scientificName": "Macrozamia mountperriensis",
            "fullName": "Macrozamia mountperriensis"
        },
        "name": "Large ribosomal subunit protein bL20c",
        "description": [
            "Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit"
        ],
        "length": 115,
        "sequence": "MTRIKRGYIARKRRKKTLAFASGSRGAHSKLFRTADQQRIRALVSAHRDRGKRKRDFRRLWITRINAAARNNGVSYNKFIRYLYKRQLLSNRRILAQIAVLDKNCFSTILNKIIE",
        "proteome": null,
        "gene": "rpl20",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019843",
                "name": "rRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dd0106d2fa935591bf6db4691453259ee8aeb0c1",
        "counters": {
            "domain_architectures": 40505,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 40505
        }
    }
}