GET /api/protein/UniProt/A0A0A2JGB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0A2JGB6",
        "id": "A0A0A2JGB6_PENEN",
        "source_organism": {
            "taxId": "27334",
            "scientificName": "Penicillium expansum",
            "fullName": "Penicillium expansum (Blue mold rot fungus)"
        },
        "name": "EKC/KEOPS complex subunit BUD32",
        "description": [
            "Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators"
        ],
        "length": 318,
        "sequence": "MTGQIIRQVRRRSYADPKERIPPGVEEVISRGSCHVGRLNDKLVLKYASDFNDPSFLMSIKVENRILQIIGPHPRIIESKGLAEDGLILKYYPNGTLRNYIKNHPCTTLERRLEWCKQLVDTLSFVHFKRVIHCDICLHNVLLDDNFDIILADFQGLVISSEDGRTLLDGLTRECAKSYMPRQHLYSASYRTDLFAVGSAMYHLIAGHEVFPELDSFDDEKIINARFMNGEFPNNDYVASHIVERCWRGQYASAAEISVDISQVLSATKAVDEALKLLGVEVVEEQQNVEKVEEYQDDGEEDGEYEEDEEYEDEDEVL",
        "proteome": "UP000030143",
        "gene": "PEX2_023590",
        "go_terms": [
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
        "counters": {
            "domain_architectures": 887312,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 887312
        }
    }
}