GET /api/protein/UniProt/A0A0A2JGB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0A2JGB6",
"id": "A0A0A2JGB6_PENEN",
"source_organism": {
"taxId": "27334",
"scientificName": "Penicillium expansum",
"fullName": "Penicillium expansum (Blue mold rot fungus)"
},
"name": "EKC/KEOPS complex subunit BUD32",
"description": [
"Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. BUD32 has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit KAE1. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators"
],
"length": 318,
"sequence": "MTGQIIRQVRRRSYADPKERIPPGVEEVISRGSCHVGRLNDKLVLKYASDFNDPSFLMSIKVENRILQIIGPHPRIIESKGLAEDGLILKYYPNGTLRNYIKNHPCTTLERRLEWCKQLVDTLSFVHFKRVIHCDICLHNVLLDDNFDIILADFQGLVISSEDGRTLLDGLTRECAKSYMPRQHLYSASYRTDLFAVGSAMYHLIAGHEVFPELDSFDDEKIINARFMNGEFPNNDYVASHIVERCWRGQYASAAEISVDISQVLSATKAVDEALKLLGVEVVEEQQNVEKVEEYQDDGEEDGEYEEDEEYEDEDEVL",
"proteome": "UP000030143",
"gene": "PEX2_023590",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
"counters": {
"domain_architectures": 887312,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 887312
}
}
}