HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0A0RY66",
"id": "A0A0A0RY66_9GENT",
"source_organism": {
"taxId": "179644",
"scientificName": "Rhabdadenia biflora",
"fullName": "Rhabdadenia biflora"
},
"name": "NADH-quinone oxidoreductase subunit C",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone",
"NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
],
"length": 158,
"sequence": "MQGRLSAWLAKHGLIHRSLGFDYQGIETLQVKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH",
"proteome": null,
"gene": "ndhJ",
"go_terms": [
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016651",
"name": "oxidoreductase activity, acting on NAD(P)H",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a773b7c7baaff38b6179f5153d2849f261faa1a6",
"counters": {
"domain_architectures": 35959,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35959
}
}
}