GET /api/protein/UniProt/A0A097KLZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A097KLZ5",
        "id": "A0A097KLZ5_9CHLO",
        "source_organism": {
            "taxId": "312850",
            "scientificName": "Lobosphaera incisa",
            "fullName": "Lobosphaera incisa"
        },
        "name": "Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein",
        "description": [
            "Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP"
        ],
        "length": 288,
        "sequence": "MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQTKDYHYENVWPEDVIYQGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCVIITDNGFDALFAANRIVASVREKARTHPLRLAGLVGNRTAKRDLIDKYVEVCQMPVLEVLPLIEDIRISRVKGKTLFEMAELEPSLYYVCDFYLNIADQLLSQPEGVVPNELQDRQLFSLLSDFYLNPQDKSNDSKTEVLDFMMV",
        "proteome": null,
        "gene": "chlL",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016730",
                "name": "oxidoreductase activity, acting on iron-sulfur proteins as donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015995",
                "name": "chlorophyll biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019685",
                "name": "photosynthesis, dark reaction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "071df9b5c0283bbb9290ef29639d54eb5a20356f",
        "counters": {
            "domain_architectures": 24594,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24594
        }
    }
}