General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A097BWT8",
        "id": "A0A097BWT8_9CAUD",
        "source_organism": {
            "taxId": "1551641",
            "scientificName": "Shigella phage pSs-1",
            "fullName": "Shigella phage pSs-1"
        },
        "name": "Anaerobic ribonucleoside-triphosphate reductase-activating protein",
        "description": [
            "Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine"
        ],
        "length": 156,
        "sequence": "MNYDRFYPCDFVNGPGCRVVLFVTGCLHKCEGCYNKSTWNARNGIPFTGETLEQLIECLNNDYIEGLTITGGDPLYPDNRDVVHCIVQTVKNLYPNKSIWLWTGYKFEDIKQLEMLKYVDVIIDGKYEKNLPTKKLWRGSDNQRLWSNTDGVWKHD",
        "proteome": "UP000029884",
        "gene": "pSs1_0087",
        "go_terms": [
            {
                "identifier": "GO:0043365",
                "name": "[formate-C-acetyltransferase]-activating enzyme activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "f4eb6e88a19b6656848688f05b40f67370b920d2",
        "counters": {
            "domain_architectures": 12735,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "sfld": 4,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12735
        }
    }
}