GET /api/protein/UniProt/A0A096NA71/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A096NA71",
"id": "A0A096NA71_PAPAN",
"source_organism": {
"taxId": "9555",
"scientificName": "Papio anubis",
"fullName": "Papio anubis (Olive baboon)"
},
"name": "Translocon-associated protein subunit gamma",
"description": [
"TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins"
],
"length": 185,
"sequence": "MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK",
"proteome": "UP000028761",
"gene": null,
"go_terms": [
{
"identifier": "GO:0006614",
"name": "SRP-dependent cotranslational protein targeting to membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "41619203312bebdafa97901f237fc2ac2687da08",
"counters": {
"domain_architectures": 2511,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2511
}
}
}