GET /api/protein/UniProt/A0A093QA97/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A093QA97",
"id": "A0A093QA97_9PASS",
"source_organism": {
"taxId": "328815",
"scientificName": "Manacus vitellinus",
"fullName": "Manacus vitellinus (golden-collared manakin)"
},
"name": "Golgi SNAP receptor complex member 2",
"description": [
"Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network"
],
"length": 204,
"sequence": "DRQVHEVQSYMGRLETSDKESVHLVENEIQARIDNIFSNLERLEILSSKEPPNKRQNAKLRVDQLKYDVQHLQTALRNFQHRRYLREQQERQREELLARTFTTNDSATTIPIDETLQYNESLQSAHRGMDELIGSGTNILQGLRDQRVTLKGTHKKILDVANMLGLSNTVMRLIEKRAFQDKFLMLGGMAVTCVIMFLVVQYLT",
"proteome": "UP000053258",
"gene": "N305_14201",
"go_terms": [
{
"identifier": "GO:0005484",
"name": "SNAP receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005794",
"name": "Golgi apparatus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "babddb636d79201488190ea40b09905148916ea3",
"counters": {
"domain_architectures": 3773,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3773
}
}
}