GET /api/protein/UniProt/A0A093PZ27/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A093PZ27",
        "id": "A0A093PZ27_9PASS",
        "source_organism": {
            "taxId": "328815",
            "scientificName": "Manacus vitellinus",
            "fullName": "Manacus vitellinus (golden-collared manakin)"
        },
        "name": "28S rRNA (uridine-N(3))-methyltransferase",
        "description": [
            "S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the N3 position of a uridine in 28S rRNA. Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level"
        ],
        "length": 351,
        "sequence": "PGKAEKKKWKEMKLLKKLEKQRVRELAEQEAKKKEEQKEEQKADRGRHHTLSVALPGSILNNAQSLELRTYLAGQIGRACAIFCVDEIVVFDEQGEDVKSVEGDFKGIGRKGNACVQLARVLQYLECPQYLRKTFFPKHEDLQFAGLLNPLDSPHHMRVDEDSEYREGVVLDRPSKPGKGSFVNCGMRKEVQIDKQLNPGLRVTVRLEEPQNPEAKVHKGTVVSSHHPRTVSGLYWGYSVRLASCLSAVFSECPFKEGYDLSIGTSERGSPVDQVTLPSFRHALVVFGGLEGLEAGVDVDPNLEVTDPSTLFDFYLNTCPGQGSRTIRTEEALLISLSALRPHIQEAVKTP",
        "proteome": "UP000053258",
        "gene": "N305_09000",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a00b518e7703acd0b00af246a94b73035a0a4f9a",
        "counters": {
            "domain_architectures": 4419,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4419
        }
    }
}