GET /api/protein/UniProt/A0A093IGI0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A093IGI0",
"id": "A0A093IGI0_FULGA",
"source_organism": {
"taxId": "30455",
"scientificName": "Fulmarus glacialis",
"fullName": "Fulmarus glacialis (Northern fulmar)"
},
"name": "Translation initiation factor eIF2B subunit gamma",
"description": [
"Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on the eukaryotic initiation factor 2 (eIF2) complex gamma subunit. Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed"
],
"length": 424,
"sequence": "GSRMTDLTSSIPKPLLPVGNRPLLWYPLNLLERAGFEEVIVITRKEIQKMLNLDTKMKLDFVCISDNMDMGTADSLRHIHQKIKTDVLVLSCDLITDVDLYKVVDLFRTHDATLSMLMKKTHEPTEVAPGQKGKKKPVEQRDFIGVDDTGKRLLFMANEADLDEELVIKRSILQKHPRMHIRTGLMDAHLYCLKKYVIDFLVENRTITSLRSELIPHLVRKQFSSTSLQQGLDNKEEDQKKKEQASLDIYSFIKEDNSLLKPASDNSCWNDHRGDMNETLHEGKVRCYVHIMKEGLCYRVNTLGLYIEANRQVPKLLLNLGLEEPLVHGSAQITDRGMIGSDSIIGSSTQVGEKTSIKHSIIGSMCTIKDKVKITNCIIMNSVTIEEGCCLQGSVICHNAVIEKGADIKDCLIGSDQRLETKGK",
"proteome": "UP000053806",
"gene": "N327_04592",
"go_terms": [
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "403b674055ea377690b4c62480d9c4419c0c44a2",
"counters": {
"domain_architectures": 2805,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2805
}
}
}