GET /api/protein/UniProt/A0A093HZB1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A093HZB1",
        "id": "A0A093HZB1_GAVST",
        "source_organism": {
            "taxId": "37040",
            "scientificName": "Gavia stellata",
            "fullName": "Gavia stellata (Red-throated diver)"
        },
        "name": "60S ribosomal protein L36",
        "description": [
            "Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell"
        ],
        "length": 74,
        "sequence": "RLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD",
        "proteome": "UP000054313",
        "gene": "N328_06539",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "06201cbcd76da6d1bf714ec057f2ac1f90c0a1a4",
        "counters": {
            "domain_architectures": 5699,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5699
        }
    }
}