General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A093HV59",
        "id": "A0A093HV59_STRCA",
        "source_organism": {
            "taxId": "441894",
            "scientificName": "Struthio camelus australis",
            "fullName": "Struthio camelus australis"
        },
        "name": "Chloride intracellular channel protein 2",
        "description": [
            "In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor. Displays weak glutathione peroxidase activity. Can insert into membranes and form chloride ion channels. Membrane insertion seems to be redox-regulated and may occur only under oxidizing conditions. Modulates the activity of RYR2 and inhibits calcium influx"
        ],
        "length": 231,
        "sequence": "LSLQAGLDGENIGNCPFCQRLFMVLWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLLFNKELKTDFIKIEEFLEQTLGPPTYPHLSPKYKESFDVGSDIFAKFSAYIKNPRKEANINFEKALLREFHRLDLYLNTPLPEEIDQDSMEDVTVSKRKFLDGDHLTLADCNLLPKLHIIKIAAKKYRDFEIPADMTGVWRYLHNAYACDEFSHTCPADEEIERTYASVAKKM",
        "proteome": "UP000053584",
        "gene": "N308_15008",
        "go_terms": [
            {
                "identifier": "GO:0005254",
                "name": "chloride channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0060315",
                "name": "negative regulation of ryanodine-sensitive calcium-release channel activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1902476",
                "name": "chloride transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6ee8c40b3cf300cf9d57d5dff4dee7903c9063ed",
        "counters": {
            "domain_architectures": 3924,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "ncbifam": 1,
                "panther": 1,
                "sfld": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3924
        }
    }
}